<<

pc 1 2
pcr
pdevsdleri 1 2
pdf
penalized
penalties
penalty 1 2
peptides
per 1 2 3 4 5
percent 1 2
percentage
perfect
performs 1 2 3 4 5 6 7
periodic
permanently 1 2 3
perspective
phe
phenylalanine
phone
physical
physicochemical
pink
places
plain
please
plus 1 2
png 1 2 3
point 1 2
policies
pop 1 2
port 1 2
portion 1 2 3 4
position 1 2 3 4
positive
positives
possibility
possible 1 2
power
powerful
preferences 1 2 3 4 5 6 7
prefs 1 2 3
presence 1 2
present 1 2
preserve
presets
press
prevent
previous 1 2
previously 1 2 3 4 5 6
price
print 1 2
prior
private
pro
problem
proc
procedure 1 2 3 4 5 6
process 1 2 3 4
processes
producing 1 2 3 4
products 1 2 3
prof_ico
prof_sum
profile 1 2 3 4 5 6 7 8 9 10 11 12 13
profiles 1 2 3 4 5 6 7 8 9 10 11
program 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
projects
proline 1 2 3
prompt 1 2
properties
property 1 2
protein 1 2 3 4 5 6 7 8 9
protocol 1 2
provided 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44
provides
proxies 1 2
proxy 1 2 3 4
public
pure
purine
purpose
put
pyl
pyrimidine
pyrrolysine


q 1 2 3
qikdllvsss 1 2
qikdllvssstdldttlvlvnaiyfkgmwktafnaedtrempfhvtkqeskpvqmmcmnnsfnvatlpae 1 2
quality
quantifies
queries 1 2 3 4 5 6 7 8 9 10
query 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23
questions 1 2 3
queued
queues
quota


r 1 2
raise 1 2
ran
random 1 2
range 1 2 3 4
ranges 1 2
rarely 1 2
rather
raw 1 2
re 1 2 3
reached 1 2 3
reactivate
reading 1 2 3 4 5 6
reagents
rearrange 1 2 3 4 5
reasonably
reasons
reboot
recall
receipt
receive 1 2 3 4 5 6
recent 1 2 3
recognized
recognizes 1 2
recommendation
records 1 2
red
reduce
redundan
redundant 1 2
reference 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44
references 1 2 3
regardless
regions 1 2 3 4 5 6
registered 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44
registration
registry 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46
registrysm
regular
related 1 2 3
relationship
relative 1 2 3
relatively 1 2
release 1 2
remove 1 2 3 4 5 6 7
removes 1 2 3
renaming 1 2 3 4
repeated
replace 1 2
report 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22
represented 1 2 3 4
request 1 2 3 4
requirement 1 2
requires
requiring 1 2 3 4 5
reserved 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45
reset
residue 1 2 3 4
residues 1 2 3 4
resize 1 2 3 4 5
respectively 1 2
restart 1 2 3
restore
restricted 1 2 3
restrictions 1 2 3 4 5 6 7 8
results 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37
retained
retrieval
retrieve 1 2 3 4 5 6 7 8
return 1 2 3 4 5 6 7 8 9
reverse
reverses 1 2 3
revert
review 1 2 3 4 5 6
reward


>>